- Recombinant Bacillus subtilis Spore maturation protein A (spmA)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1101505
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 21,494 Da
- E Coli or Yeast
- 1-196
- Spore maturation protein A (spmA)
Sequence
MVNIIWVSLTVIGLVFAMCNGTLQDVNEAVFKGAKEAITISFGLMSVLVFWLGLMKIAEQSGLLDIFSRMCRPFISKLFPDIPPDHPAMGYILSNLMANFFGLGNAATPLGIKAMEQMKKLNGNRSEASRSMITFLAVNTSCITLIPTTVIAVRMAYSSKTPTDIVGPSILATLISGIGAIIIDRYFYYRRKKKGR